« Zurück
Startseite /
Recombinant Bovine Synaptic vesicle glycoprotein 2A(SV2A),partial

Recombinant Bovine Synaptic vesicle glycoprotein 2A(SV2A),partial

ArtNr	CSB-YP022978BO-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MEEGFRDRAAFIRGAKDIAKEVKKHATKKVVKGLD RVQDEYSRRSYSRFEEEDDDDDFPAPADGYYRGEG AQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAE SGGKGERMADGAPLAGVRGGLGDGEGPPGGRGEAQ RRKEREELAQQYEAILRECGHGRFQWTLY
Protein Familie	Major facilitator superfamily
Citations	"Identification, characterization, and molecular cloning of a novel transporter-like protein localized to the central nervous system." Gingrich J.A., Andersen P.H., Tiberi M., el Mestikawy S., Jorgensen P.N., Fremeau R.T. Jr., Caron M.G. FEBS Lett. 312:115-122(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	p87
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	22.3 kDa
General Research Areas	Neuroscience
Relevance	Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles
Expression Region	1-169aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles (By similarity).
Subcellular Location	Cell junction, synapse, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Multi-pass membrane protein
Gene Names	SV2A
Sequence Info	Partial
Organism	Bos taurus (Bovine)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP022978BO-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern