Vergleich

Recombinant Mouse Toll-like receptor 4(Tlr4),partial

ArtNr CSB-YP023603MO-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDL SFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDK AWHGLHHLSNLILTGNPIQSFSPGSFSGLTSLENL VAVETKLASLESFPIGQLITLKKLNVAHNFIHSCK LPAYFSNLTNLVHVDLSYNYIQTITVNDLQFLREN PQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGN FNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEI FEP
Protein Familie Toll-like receptor family
Citations "Genetic and physical mapping of the Lps locus: identification of the Toll-4 receptor as a candidate gene in the critical region."
Poltorak A., Smirnova I., He X., Liu M.-Y., Van Huffel C., Birdwell D., Alejos E., Silva M., Du X., Thompson P., Chan E.K.L., Ledesma J., Roe B., Clifton S., Vogel S.N., Beutler B.
Blood Cells Mol. Dis. 24:340-355(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD_antigen: CD284
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
71.5 kDa
General Research Areas
Immunology
Relevance
Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL-) and mediates the cytokine release induced by LDL
Expression Region
26-638aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS)
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Early endosome
Tissue Specificity
Highly expressed in heart, spleen, lung and muscle. Lower levels are found in liver and kidney. Expressed in macrophages.
Involvement in disease
The protein is encoded by the Lps locus, an important susceptibility locus, influencing the propensity to develop a disseminated Gram-negative infection.
Gene Names
Tlr4
Sequence Info
Partial
Organism
Mus musculus (Mouse)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen