Vergleich

Recombinant Rotavirus A Outer capsid glycoprotein VP7

ArtNr CSB-YP311455RFS-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QNYGINLPITGSMDASYVNATKDKPFLTSTLCLYY PTEARTEINDNEWTSTLSQLFLTKGWPTGSVYFKE YDDIATFSVDPQLYCDYNIVLMRYNSSLELDMSEL ANLILNEWLCNPMDITLYYYQQTDEANKWIAMGQS CTIKVCPLNTQTLGIGCQTTNARTFEEVATAEKLV ITDVVDGVNHKLDVTTATCTIRNCKKLGPRENVAV IQVGGADILNITSDPTTAPQTERMMRINWKKWWQV FYT
Protein Familie Rotavirus VP7 family
Citations "Molecular and antigenic analyses of serotypes 8 and 10 of bovine rotaviruses in Thailand."
Taniguchi K., Urasawa T., Pongsuwanna Y., Choonthanom M., Jayavasu C., Urasawa S.
J. Gen. Virol. 72:2929-2937(1991)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
33.3 kDa
Relevance
Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved
Expression Region
51-326aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved (By similarity).
Subcellular Location
Virion, Host endoplasmic reticulum lumen
Sequence Info
Full Length of Mature Protein
Organism
Rotavirus A (isolate RVA/Cow/Thailand/A44/1988/G10P8[11]) (RV-A)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen