Vergleich

Recombinant Rotavirus A Intermediate capsid protein VP6

ArtNr CSB-YP321618RGK-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDVLYSLSKTLKDARDKIVEGTLYSNVSDLIQQFN QMIITMNGNEFQTGGIGNLPIRNWNFDFGLLGTTL LNLDANYVETARNTIDYFVDFVDNVCMDEMVRESQ RNGIAPQSDSLIKLSGIKFKRINFDNSSEYIENWN LQNRRQRTGFTFHKPNIFPYSASFTLNRSQPAHDN LMGTMWLNAGSEIQVAGFDYSCAINAPANTQQFEH IVQLRRVLTTATITLLPDAERFSFPRVITSADGAT TWY
Protein Familie Rotavirus VP6 family
Citations Nucleotide sequence of group antigen (VP6) of the UK tissue culture adapted strain of bovine rotavirus.Tarlow O., McCrae M.A.Nucleic Acids Res. 18:4921-4921(1990)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
46.9 kDa
Relevance
Intermediate capsid protein that self assbles to form an icosahedral capsid with a T=13 symmetry, which consists of 230 trimers of VP6, with channels at each of its five-fold vertices. This capsid constitutes the middle concentric layer of the viral mature particle. The innermost VP2 capsid and the intermediate VP6 capsid rain intact following cell entry to protect the dsRNA from degradation and to prevent unfavorable antiviral responses in the host cell during all the replication cycle of the virus. Nacent transcripts are transcribed within the structural confines of this double-layered particle (DLP) and are extruded through the channels at the five-fold axes. VP6 is required for the transcription activity of the DLP .
Expression Region
1-397aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Intermediate capsid protein that self assembles to form an icosahedral capsid with a T=13 symmetry, which consists of 230 trimers of VP6, with channels at each of its five-fold vertices. This capsid constitutes the middle concentric layer of the viral mature particle. The innermost VP2 capsid and the intermediate VP6 capsid remain intact following cell entry to protect the dsRNA from degradation and to prevent unfavorable antiviral responses in the host cell during all the replication cycle of the virus. Nascent transcripts are transcribed within the structural confines of this double-layered particle (DLP) and are extruded through the channels at the five-fold axes. VP6 is required for the transcription activity of the DLP.
Subcellular Location
Virion
Sequence Info
Full Length
Organism
Rotavirus A (strain RVA/Cow/France/RF/1975/G6P6[1]) (RV-A)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen