« Zurück
Startseite /
Recombinant Escherichia coli RNA-splicing ligase RtcB(rtcB)

Recombinant Escherichia coli RNA-splicing ligase RtcB(rtcB)

ArtNr	CSB-YP341647ENV-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MNYELLTTENAPVKMWTKGVPVEADARQQLINTAK MPFIFKHIAVMPDVHLGKGSTIGSVIPTKGAIIPA AVGVDIGCGMNALRTALTAEDLPENLAELRQAIET AVPHGRTTGRCKRDKGAWENPPVNVDAKWAELEAG YQWLTQKYPRFLNTNNYKHLGTLGTGNHFIEICLD ESDQVWIMLHSGSRGIGNAIGTYFIDLAQKEMQET LETLPSRDLAYFMEGTEYFDDYLKAVAWAQLFASL NRD
Protein Familie	RtcB family
Citations	The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	47.2 kDa
Relevance	RNA ligase that mediates the joining of broken tRNA-like st-loop structures in case of tRNA damage. Probably participates to tRNA restriction-repair by ligating broken tRNA-like st-loop structures with 2', 3'-cyclic phosphate and 5'-OH ends to form a splice junction with a 2'-OH, 3', 5'-phosphodiester, a step that requires GTP . Also acts as a DNA ligase in case of DNA damage by splicing 'dirty' DNA breaks, characterized by 3'-PO4 (or cyclic-PO4) and 5'-OH ends that cannot be sealed by classical DNA ligases .
Expression Region	1-408aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	RNA ligase that mediates the joining of broken tRNA-like stem-loop structures in case of tRNA damage. Probably participates to tRNA restriction-repair by ligating broken tRNA-like stem-loop structures with 2', 3'-cyclic phosphate and 5'-OH ends to form a splice junction with a 2'-OH, 3', 5'-phosphodiester, a step that requires GTP
Gene Names	rtcB
Sequence Info	Full Length
Organism	Escherichia coli (strain K12)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP341647ENV-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern