Vergleich

Recombinant Hepatitis delta virus genotype I Small delta antigen

ArtNr CSB-YP361989HFN-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Konjugat/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MSRSESRKNRGGREEILEQWVAGRKKLEELERDLR KTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPP AKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRR KALENKKKQLSAGGKNLSKEEEEELRRLTEEDERR ERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVP ESPFSRTGEGLDIRGNRGFP
Protein Familie Hepatitis delta antigen family
Citations "Characterization of hepatitis delta antigen: specific binding to hepatitis delta virus RNA."
Lin J.-H., Chang M.F., Baker S.C., Govindarajan S., Lai M.M.C.
J. Virol. 64:4051-4058(1990)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias p24
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
25.4 kDa
Relevance
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome
Expression Region
1-195aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome (By similarity).
Subcellular Location
Virion, Host nucleus
Biologically active
Not Test
Protein length
Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen