« Zurück
Startseite /
Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)

Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)

ArtNr	CSB-YP510513KBG-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTS YLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQT AQILNWIKQEINLPVALAVVTHAHQDKMGGMDALH AAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW VEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDI AFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGA AFPKASMIVMSHSAPDSRAAITHTARMADKLR
Protein Familie	Metallo-beta-lactamase superfamily, Class-B beta-lactamase family
Citations	Emergence of a new antibiotic resistance mechanism in India, Pakistan, and the UK a molecular, biological, and epidemiological study.Kumarasamy K.K., Toleman M.A., Walsh T.R., Bagaria J., Butt F., Balakrishnan R., Chaudhary U., Doumith M., Giske C.G., Irfan S., Krishnan P., Kumar A.V., Maharjan S., Mushtaq S., Noorie T., Paterson D.L., Pearson A., Perry C. , Pike R., Rao B., Ray U., Sarma J.B., Sharma M., Sheridan E., Thirunarayan M.A., Turton J., Upadhyay S., Warner M., Welfare W., Livermore D.M., Woodford N.Lancet Infect. Dis. 10:597-602(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Metallo-beta-lactamase NDM-1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	27.6 kDa
Relevance	Confers resistance to many beta-lactam antibiotics, including some carbapens. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Expression Region	29-270aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Subcellular Location	Periplasm
Gene Names	blaNDM-1
Sequence Info	Full Length of Mature Protein
Organism	Klebsiella pneumoniae
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP510513KBG-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern