« Zurück
Startseite /
Recombinant Escherichia coli Chaperone protein DnaK(dnaK)

Recombinant Escherichia coli Chaperone protein DnaK(dnaK)

ArtNr	CSB-YP633459EGW-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neuroinflammation Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRT TPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIK RLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEV KGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVI TVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAA ALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEV DGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK KDQ
Protein Familie	Heat shock protein 70 family
Citations	"Identification of genes subject to positive selection in uropathogenic strains of Escherichia coli: a comparative genomics approach." Chen S.L., Hung C.-S., Xu J., Reigstad C.S., Magrini V., Sabo A., Blasiar D., Bieri T., Meyer R.R., Ozersky P., Armstrong J.R., Fulton R.S., Latreille J.P., Spieth J., Hooton T.M., Mardis E.R., Hultgren S.J., Gordon J.I.Proc. Natl. Acad. Sci. U.S.A. 103:5977-5982(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSP70 ; Heat shock 70KDA protein ; Heat shock protein 70
Lieferbar
Manufacturer - Targets	dnaK
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	71.1 kDa
General Research Areas	Signal Transduction
Relevance	Acts as a chaperone.
Expression Region	1-638aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a chaperone.
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP633459EGW-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern