« Zurück
Startseite /
Recombinant Human Lipid phosphate phosphatase-related protein type 2(LPPR2),partial

Recombinant Human Lipid phosphate phosphatase-related protein type 2(LPPR2),partial

ArtNr	CSB-YP836219HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYR LEFTDTFPVHTQGFFCYDSTYAKPYPGPEAASRVP PALVYALVTAGPTLTILLGELARAFFPAPPSAVPV IGESTIVSGACCRFSPPVRRLVRFLGVYSFGLFTT TIFANAGQVVTGNPTP
Protein Familie	PA-phosphatase related phosphoesterase family
Citations	"A new phospholipid phosphatase, PRG-1, is involved in axon growth and regenerative sprouting." Braeuer A.U., Savaskan N.E., Kuehn H., Prehn S., Ninnemann O., Nitsch R. Nat. Neurosci. 6:572-578(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lipid phosphate phosphatase-related protein type 2 (Plasticity-related gene 4 protein) (PRG-4)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	18.1 kDa
General Research Areas	Signal Transduction
Expression Region	1-156aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Membrane, Multi-pass membrane protein
Gene Names	LPPR2
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern