« Zurück
Startseite /
Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial

Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial

ArtNr	CSB-EP012911RA-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLT YLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEAN AFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKY LSICNTGIRTLPDVTKISSSEFNFILEICDNLHIT TIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGT TLISLELKENIYLEKMHSGAFQGATGPSILDISST KLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTS LLV
Protein Familie	G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Citations	The lutropin/choriogonadotropin receptor is palmitoylated at intracellular cysteine residues.Zhu H., Wang H., Ascoli M.Mol. Endocrinol. 9:141-150(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Luteinizing hormone receptor ;LSH-R
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	53.2 kDa
Relevance	Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Expression Region	27-362aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Subcellular Location	Cell membrane, Multi-pass membrane protein, Secreted
Gene Names	Lhcgr
Sequence Info	Extracellular Domain
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP012911RA-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern