« Back
Home /
Interleukin-1 beta (IL-1beta), RhesusMacaque

Interleukin-1 beta (IL-1beta), RhesusMacaque

Item no.	Z02758-10
Manufacturer	GenScript
Amount	10 ug
Quantity options	1 mg 10 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Cholesterol & Lipid Metabolism By Cell Type Hematology Leukemia Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines Cytoskeleton Cell Stainings ECM Intermediate filaments
Type	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	other
Purity	>98% by SDS-PAGE and HPLC analyses.
Sequence	APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02758-Interleukin-1_beta_IL-1beta_Rhesus_Macaque, IL-1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. The 17 kDa mature rhesus IL1ß shares 96% aa sequence identity with human IL-1 beta.</td></tr><tr><th>M.W.</th><td colspan="7"> Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >98% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rRhIL-1 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL,corresponding to a specific activity of > 1.0×108 units/mg.</td></tr><tr><th>Storage</th><td colspan="7"> This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7"> Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.</td></tr><tr><th>Reconstitution</th><td colspan="7"> We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.</td></tr><tr><th>Physical Appearance</th><td colspan="7"> Sterile Filtered White lyophilized (freeze-dried) powder.</td></tr><tr><th>Usage</th><td colspan="7"> This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.</td></tr><tr><th>Sequence</th><td colspan="7"> APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS</td></tr>
Similar products	Interleukin-1
Available
Specificity	Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL,corresponding to a specific activity of > 1.0x108 units/mg.
Country of Origin	USA
Storage Conditions	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight	Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
Product Line	Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity	Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL, corresponding to a specific activity of > 1.0x108 units/mg.
Description	IL-1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. The 17 kDa mature rhesus IL1ß shares 96% aa sequence identity with human IL-1 beta.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Formulation	Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Endotoxin Level	Less than 0.2EU/ug of rRhIL-1 as determined by LAL method.
Usage	This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Z02758-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer