« Zurück
Startseite /
Integrin-β1/CD29 Rabbit mAb

Integrin-β1/CD29 Rabbit mAb

ArtNr	A21220-20uL
Hersteller	Abclonal
Menge	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAI
NCBI	ITGB1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CD29, FNRB, MDF2, VLAB, GPIIA, MSK12, VLA-BETA, Integrin-β1/CD29
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-728 of human Integrin-β1/CD29 (NP_002202.2).
Recommended Dilution	WB, 1:2000 - 1:10000\|IHC-P, 1:1000 - 1:5000\|IF/ICC, 1:50 - 1:200
Protein Size	88kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, PI3K-Akt Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Cell Adhesion, Cytoskeleton, Immunology Inflammation, CDs, Neuroscience, Cell Type Marker, Stem Cells, Embryonic Stem Cells, Mesenchymal Stem Cells

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A21220-20uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 uL

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern