« Back
Home /
Integrin-β1/CD29 Rabbit mAb

Integrin-β1/CD29 Rabbit mAb

Item no.	A21220-20uL
Manufacturer	Abclonal
Amount	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAI
NCBI	ITGB1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CD29, FNRB, MDF2, VLAB, GPIIA, MSK12, VLA-BETA, Integrin-β1/CD29
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-728 of human Integrin-β1/CD29 (NP_002202.2).
Recommended Dilution	WB, 1:2000 - 1:10000\|IHC-P, 1:1000 - 1:5000\|IF/ICC, 1:50 - 1:200
Protein Size	88kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, PI3K-Akt Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Cell Adhesion, Cytoskeleton, Immunology Inflammation, CDs, Neuroscience, Cell Type Marker, Stem Cells, Embryonic Stem Cells, Mesenchymal Stem Cells

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A21220-20uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 uL

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer