« Zurück
Startseite /
Recombinant Human Epiplakin(EPPK1) ,partial

Recombinant Human Epiplakin(EPPK1) ,partial

ArtNr	CSB-EP007745HU-20
Hersteller	Cusabio
Menge	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTP PRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGL GQALLEAQAATGGLVDLARGQLLPVSKALQQGLVG LELKEKLLAAERATTGYPDPYGGEKLALFQAIGKE VVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPAC HQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLT YHQLLERCVRAPGSG
Protein Familie	Plakin or cytolinker family
Citations	An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	450KDA epidermal antigen
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	27.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Expression Region	1-225aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytoskeletal linker protein that connects to intermediate filaments and controls their reorganization in response to stress
Subcellular Location	Cytoplasm, cytoskeleton, Cell junction, hemidesmosome, Cell junction, tight junction, Cell projection, Apicolateral cell membrane, Basolateral cell membrane, Cell junction
Tissue Specificity	Expressed in epithelial cells of liver, small intestine, colon, salivary glands, stomach and appendix.
Gene Names	EPPK1
Sequence Info	Partial
Organism	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP007745HU-20-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 28.08.2025