« Zurück
Startseite /
Recombinant Human Tissue factor pathway inhibitor(TFPI),partial (Active)

Recombinant Human Tissue factor pathway inhibitor(TFPI),partial (Active)

ArtNr	CSB-MP023437HU-20ug
Hersteller	Cusabio
Menge	20 ug
Quantity options	100 ug 1 mg 20 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human (Homo sapiens)
Konjugat/Tag	HIS
Purity	Greater than 95% as determined by SDS-PAGE.
Sequence	DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	(TFPI)(Extrinsic pathway inhibitor)(EPI)(Lipoprotein-associated coagulation inhibitor)(LACI)
Lieferbar
Manufacturer - Conjugate / Tag	C-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight	31.9 kDa
Buffer	Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Relevance	Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Expression Region	29-282aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Gene Names	TFPI
Sequence Info	Partial
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human TFPI at 1 ?g/mL can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 1.242-1.788 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP023437HU-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern