« Zurück
Startseite /
Recombinant Saxiphilin ,partial for Lithobates catesbeiana,partial

Recombinant Saxiphilin ,partial for Lithobates catesbeiana,partial

ArtNr	CSB-MP339158LQA-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Konjugat/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIAC TEASCPKGCVKQILKGEADAVKLEVQYMYEALMCG LLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVAL VKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSL IRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGD PKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVA FVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDG SRA
Protein Familie	Transferrin family
Citations	Purification and partial sequencing of saxiphilin, a saxitoxin-binding protein from the bullfrog, reveals homology to transferrin.Li Y., Moczydlowski E.J. Biol. Chem. 266:15481-15487(1991).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SAX
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.7 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Microbiology
Relevance	Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Expression Region	484-844aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Subcellular Location	Secreted
Tissue Specificity	Plasma. Highest levels of transcripts found in the liver, the lung, the pancreas and the brain.
Sequence Info	Partial
Organism	Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP339158LQA-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern