Vergleich

Recombinant Enterobacteria phage M13 Attachment protein G3P(III)

ArtNr CSB-YP303116ECY-20
Hersteller Cusabio
Menge 20 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEG CLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGG GSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINP LDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNR FRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKA MYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDL PQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSE GGG
Protein Familie Inovirus G3P protein family
Citations Filamentous phage infection: crystal structure of g3p in complex with its coreceptor, the C-terminal domain of TolA.Lubkowski J., Hennecke F., Plueckthun A., Wlodawer A.Structure 7:711-722(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Gene 3 protein; Short name:; G3P; Minor coat protein
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
44.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Plays essential roles both in the penetration of the viral genome into the bacterial host via pilus retraction and in the extrusion process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of host F-pilus. Subsequent interaction with the host entry receptor tolA induces penetration of the viral DNA into the host cytoplasm. In the extrusion process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain.
Expression Region
19-424aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays essential roles both in the penetration of the viral genome into the bacterial host via pilus retraction and in the extrusion process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of host F-pilus. Subsequent interaction with the host entry receptor tolA induces penetration of the viral DNA into the host cytoplasm. In the extrusion process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain.
Subcellular Location
Virion, Host membrane, Single-pass type I membrane protein
Gene Names
III
Sequence Info
Full Length of Mature Protein
Organism
Enterobacteria phage M13 (Bacteriophage M13)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen