« Zurück
Startseite /
Recombinant Human CCL3L1/MIP-1 alpha Isoform LD78 beta Protein

Recombinant Human CCL3L1/MIP-1 alpha Isoform LD78 beta Protein

ArtNr	RP00853-10ug
Hersteller	Abclonal
Menge	10 ug
Quantity options	10 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLEPSA
NCBI	CCL3L1/MIP-1 alpha Isoform LD78 beta
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-C Motif Chemokine 3-Like 1,G0/G1 Switch Regulatory Protein 19-2,LD78-Beta(1-70),PAT 464.2,Small-Inducible Cytokine A3-Like 1,Tonsillar Lymphocyte LD78 Beta Protein,CCL3L1,D17S1718,G0S19-2,SCYA3L1,CCL3L3
Lieferbar
Manufacturer - Category	Proteins
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen	Ala24-Ala93
Route	C-6xHis
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine Receptors
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.2.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00853-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern