« Zurück
Startseite /
Recombinant Human S100-A8&S100-A9 Protein

Recombinant Human S100-A8&S100-A9 Protein

ArtNr	RP01253-20ug
Hersteller	Abclonal
Menge	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	>95% by SDS-PAGE.
Sequence	MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE//
NCBI	S100-A8&S100-A9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CAGA,CAGB,CFAG,MRP14,MRP8&S100A9,S100A8,Calprotectin,S100A8&S100A9
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Other Recombinant Protein
Shipping Temperature	ice pack
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Availability	Inquiry before order
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human S100-A8&S100-A9 Protein is produced by Baculovirus-Infected Sf9 Cells expression system. The target protein is expressed with sequence (Met1-Glu93&Met1-Pro114) of human S100A8&S100A9 Heterodimer (Accession #NP_002955.2/NP_002956.1) fused with a 6xHis tag at the C-terminus(S100A8).
Immunogen	Met1-Glu93(S100A8)&Met1-Pro114(S100A9)
Route	C-His(S100A8)&No tag(S100A9)
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, 1mM DTT, pH 7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01253-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern