Recombinant Mouse B7-H5/Gi24/VISTA Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

VSIR, V-Set Immunoregulatory Receptor, also known as VISTA, is an immunoregulatory receptor that inhibits the T-cell response. It may promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. VSIR, or V-set immunoregulatory receptor, could be involved in the pathogenesis of chronic rhinosinusitis with nasal polyps. V-domain Immunoglobulin Suppressor of T cell Activation (VISTA) is an inhibitory immune-checkpoint molecule that suppresses CD4+ and CD8+ T cell activation when expressed on antigen-presenting cells. VSIR is broadly expressed in the spleen, bone marrow, and other tissues. Diseases associated with VSIR include Ichthyosis, Congenital, Autosomal Recessive 6, and Monckeberg Arteriosclerosis.

Phe33-Ala191

< 0.1 EU/μg of the protein by LAL method.

FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNF TLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKN HHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

B7-H5/Gi24/VISTA