Vergleich

Recombinant Human CXCL4/PF-4 Protein Europäischer Partner

ArtNr RP01774-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 97% by SDS-PAGE.
Sequence EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
NCBI CXCL4
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PF-4,CXCL4,SCYB4
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
<0.1EU/μg
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
8.61 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human CXCL4/PF-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu32-Ser101) of human PF-4/CXCL4/SCYB4 (Accession #NP_002610.1) fused with and a 6×His tag at the C-terminus.
Background
CXCL4, or Platelet factor 4 (PF4), is a small cytokine belonging to the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. CXCL4 is chemotactic for neutrophils and monocytes and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. CXCL4/PF4 is up-regulated in human liver fibrosis and that it plays a nonredundant, functional role in experimental liver fibrosis by mediating stellate cell proliferation, migration, and intrahepatic immune cell recruitment.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Glu32-Ser101
Route
C-His
Endotoxin
<0.1EU/μg
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 10 mM Sodium Citrate, 150 mM NaCl, pH5.0 .
Expected Protein Size
8.61 kDa
Gene Symbol
CXCL4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen