Vergleich

LDH (Plasmodium falciparum) Europäischer Partner

ArtNr RLT-400-003
Hersteller ReliaTech
Menge 25ug
Kategorie
Typ Cytokines and Growth Factors
Format Liquid
Specific against Human (Homo sapiens)
Host Insect Cells
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias lactate dehydrogenase
Lieferbar
Uniprot
Q71T02
Buffer
50 mM Tris, 250 mM NaCl, 1 mM EDTA
Description
Malaria is one of the most widespread infectious diseases affecting some 500 million people with an enormous cost in human suffering and economic hardship. Effective treatment of the disease is increasingly compromised by rising resistance of malaria parasites to currently available anti-malarials. The parasites are homolactate fermenters and rely on glycolysis for energy generation since the parasites appear to lack a functional citric acid cycle. The NAD+ consumed during glycolysis is reduced to NADH by lactate which, in turn, is oxidized to pyruvate. This reaction is catalyzed by lactate dehydrogenase (LDH). It has been demonstrated that inhibitors of this enzyme have parasiticidal activity. Since LDH from the malaria parasite Plasmodium falciparum (PfLDH) has notable structural and kinetic differences from human LDHs, the enzyme appears to be an attractive target for novel anti-malarial therapeutics. The parasite, P. falciparum, is the most lethal of malarial plasmodia being responsible for the cerebral form of the disease; consequently it has been the major focus of initial biochemical and genomic investigation. On the other hand, the parasite P. vivax is of great importance as it is the most widespread and common of the malarial plasmodia and, therefore, is responsible for the greatest burden of disease.
Length [aa]
319
Molecular Weight
35 kDa
mRNA RefSeq
AF251291.1
Protein RefSeq
AAG14292.1
Protein Sequence
PLAMAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLK
Purity Confirmation
> 85% by SDS-PAGE & Coomassie stain
Stability And Storage
According to the available data the liquid protein stored at 4-8°C is stable at least for about 10 months.
Synonyms
lactate dehydrogenase
Uniprot ID
Q71T02

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 25ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen