Comparison

LDH (Plasmodium falciparum) European Partner

Item no. RLT-400-003
Manufacturer ReliaTech
Amount 25ug
Category
Type Cytokines and Growth Factors
Format Liquid
Specific against Human (Homo sapiens)
Host Insect Cells
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias lactate dehydrogenase
Available
Uniprot
Q71T02
Buffer
50 mM Tris, 250 mM NaCl, 1 mM EDTA
Description
Malaria is one of the most widespread infectious diseases affecting some 500 million people with an enormous cost in human suffering and economic hardship. Effective treatment of the disease is increasingly compromised by rising resistance of malaria parasites to currently available anti-malarials. The parasites are homolactate fermenters and rely on glycolysis for energy generation since the parasites appear to lack a functional citric acid cycle. The NAD+ consumed during glycolysis is reduced to NADH by lactate which, in turn, is oxidized to pyruvate. This reaction is catalyzed by lactate dehydrogenase (LDH). It has been demonstrated that inhibitors of this enzyme have parasiticidal activity. Since LDH from the malaria parasite Plasmodium falciparum (PfLDH) has notable structural and kinetic differences from human LDHs, the enzyme appears to be an attractive target for novel anti-malarial therapeutics. The parasite, P. falciparum, is the most lethal of malarial plasmodia being responsible for the cerebral form of the disease; consequently it has been the major focus of initial biochemical and genomic investigation. On the other hand, the parasite P. vivax is of great importance as it is the most widespread and common of the malarial plasmodia and, therefore, is responsible for the greatest burden of disease.
Length [aa]
319
Molecular Weight
35 kDa
mRNA RefSeq
AF251291.1
Protein RefSeq
AAG14292.1
Protein Sequence
PLAMAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLK
Purity Confirmation
> 85% by SDS-PAGE & Coomassie stain
Stability And Storage
According to the available data the liquid protein stored at 4-8°C is stable at least for about 10 months.
Synonyms
lactate dehydrogenase
Uniprot ID
Q71T02

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close