« Back
Home /
Recombinant Human BY55/CD160 Protein

Recombinant Human BY55/CD160 Protein

Item no.	RP00566-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Specific against	Human (Homo sapiens)
Purity	> 90% by SDS-PAGE.
NCBI	BY55/CD160
Alias	CD160,BY55,NK1,NK28
Available
Manufacturer - Applications	<0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	15.64 kDa
Description	Recombinant Human CD160 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ile27-Ser159) of human CD160 (Accession #O95971) fused with a 6×His tag at the C-terminus.
Background	CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in thespleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cellsand CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for bothclassical and non-classical MHC class I molecules.
Manufacturer - Cross Reactivity	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ile27-Ser159
Route	C-His
Manufacturer - Research Area	Bio-Markers & CD Antigens
Antigen Seq	INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size	15.64 kDa
Gene Symbol	BY55/CD160

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00566-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer