« Zurück
Startseite /
Recombinant SARS-CoV-2 papain-like protease Protein

Recombinant SARS-CoV-2 papain-like protease Protein

ArtNr	RP01274LQ-1000ug
Hersteller	Abclonal
Menge	1000 ug
Quantity options	1000 ug 100 ug 10 ug 1 mg
Specific against	SARS-CoV-2
Purity	> 90% by SDS-PAGE.
Dry ice	Yes
NCBI	SARS-CoV-2 papain-like protease
Alias	PLPro,PL-PRO,pp1a,Papain-like Protease,Replicase polyprotein 1a,ORF1a polyprotein,Plpro,COVID-19
Versandbedingung	Trockeneis
Lieferbar
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	dry ice
Storage Conditions	Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight	37.47 kDa
Description	Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met, a 6×His tag at the N-terminus.
Immunogen	Glu1564-Lys1878
Route	N-His
Manufacturer - Research Area	SARS-CoV-2 antigens
Antigen Seq	EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
Protein Formulation	Supplied as a 0.22 μm filtered solution in 20mM Tris, 20% Glycerol, 10mM β-Me，pH7.5.Contact us for customized product form or formulation.
Expected Protein Size	37.47 kDa
Gene Symbol	SARS-CoV-2 papain-like protease

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01274LQ-1000ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern