« Back
Home /
Recombinant SARS-CoV-2 papain-like protease Protein

Recombinant SARS-CoV-2 papain-like protease Protein

Item no.	RP01274LQ-1000ug
Manufacturer	Abclonal
Amount	1000 ug
Quantity options	1000 ug 100 ug 10 ug 1 mg
Specific against	SARS-CoV-2
Purity	> 90% by SDS-PAGE.
Dry ice	Yes
NCBI	SARS-CoV-2 papain-like protease
Alias	PLPro,PL-PRO,pp1a,Papain-like Protease,Replicase polyprotein 1a,ORF1a polyprotein,Plpro,COVID-19
Shipping Condition	Dry ice
Available
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	dry ice
Storage Conditions	Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight	37.47 kDa
Description	Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met, a 6×His tag at the N-terminus.
Immunogen	Glu1564-Lys1878
Route	N-His
Manufacturer - Research Area	SARS-CoV-2 antigens
Antigen Seq	EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
Protein Formulation	Supplied as a 0.22 μm filtered solution in 20mM Tris, 20% Glycerol, 10mM β-Me，pH7.5.Contact us for customized product form or formulation.
Expected Protein Size	37.47 kDa
Gene Symbol	SARS-CoV-2 papain-like protease

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01274LQ-1000ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer