Vergleich

Recombinant SARS-CoV-2 papain-like protease Protein Europäischer Partner

ArtNr RP01274LQ-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 1000 ug 100 ug 10 ug 1 mg
Kategorie
Typ Proteins
Specific against SARS-CoV-2
Purity > 90% by SDS-PAGE.
NCBI SARS-CoV-2 papain-like protease
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PLPro,PL-PRO,pp1a,Papain-like Protease,Replicase polyprotein 1a,ORF1a polyprotein,Plpro,COVID-19
Lieferbar
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
37.47 kDa
Description
Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met, a 6×His tag at the N-terminus.
Immunogen
Glu1564-Lys1878
Route
N-His
Manufacturer - Research Area
SARS-CoV-2 antigens
Antigen Seq
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
Protein Formulation
Supplied as a 0.22 μm filtered solution in 20mM Tris, 20% Glycerol, 10mM β-Me,pH7.5.Contact us for customized product form or formulation.
Expected Protein Size
37.47 kDa
Gene Symbol
SARS-CoV-2 papain-like protease

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 18.12.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen