Comparison

Recombinant SARS-CoV-2 papain-like protease Protein European Partner

Item no. RP01274LQ-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 1000 ug 100 ug 10 ug 1 mg
Category
Type Proteins
Specific against SARS-CoV-2
Purity > 90% by SDS-PAGE.
NCBI SARS-CoV-2 papain-like protease
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PLPro,PL-PRO,pp1a,Papain-like Protease,Replicase polyprotein 1a,ORF1a polyprotein,Plpro,COVID-19
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
37.47 kDa
Description
Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met, a 6×His tag at the N-terminus.
Immunogen
Glu1564-Lys1878
Route
N-His
Manufacturer - Research Area
SARS-CoV-2 antigens
Antigen Seq
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
Protein Formulation
Supplied as a 0.22 μm filtered solution in 20mM Tris, 20% Glycerol, 10mM β-Me,pH7.5.Contact us for customized product form or formulation.
Expected Protein Size
37.47 kDa
Gene Symbol
SARS-CoV-2 papain-like protease

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 12/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close