Vergleich

Recombinant Human IFN-alpha 2 Protein Europäischer Partner

ArtNr RP01432-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 100 ug 10 ug 20 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
NCBI IFN-alpha 2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IFNA2,IFN-alphaA,IFNA,IFNA2B,INFA2,interferon alpha-2,Interferon alpha 2 (IFN-α2) ,IFN-alphaA,IFNA,IFNA2B,INFA2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
Please contact us for more information.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
20.08 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human IFN-alpha 2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu188) of human Interferon alpha 2/IFNA2 (Accession #NP_000596.2) fused with a 6×His tag at the C-terminus.
Background
IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interferons (IFNs) are well-known cytokines that exert antiviral activity, antitumor activity, and immunomodulatory effects. Interferon tau (IFNT), a type I IFN similar to alpha IFNs (IFNA), is the pregnancy recognition signal produced by the ruminant conceptus. Among the IFN-α genes, a total of 28 different sequence variants have been described. The three principal subtypes of IFNα-2 are designated α-2a, α-2b, and α-2c. IFNα-2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Cys24-Glu188
Route
C-His
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Bioactivity
1. Measured by its binding ability in a functional ELISA.Immobilized Human IFNA2 at 2 μg/mL (100 μL/well) can bind Human IFNAR2 with a linear range of 0. 2-617ng/mL.|2. Recombinant human IFN-α2 (10 ng/mL) was used to treat HCT116 cells. Western-blot result showed that both the level of phosphorylated STAT1 and STAT3 were increased, indicating the stimulation was successful.(Customer Feedback Data)
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size
20.08 kDa
Gene Symbol
IFN-alpha 2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen