Glucagon Like Peptide-2, Human (GLP-2)

Molecular Biology / MB-Hormones, Steroids

-20°C

Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.

Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.

Source:
Synthetic human Glucagon Like Peptide-2

AA Sequence:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.