Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)

Blue Ice

41, 9

Supplied as a liquid in Tris, 50% glycerol.

May be involved in the regulation of dopamine release and transport.

Source:
Recombinant protein corresponding to aa1-140 from rat Snca, fused to GST-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~41.9kD

Amino Acid Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.