ESAT-6-like Protein EsxH, Recombinant, Mycobacterium Tuberculosis, aa2-96, His-SUMO-Tag (EsxH, CFP-7)

Blue Ice

26, 25

Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.

Partial recombinant protein corresponding to aa2-96 from Mycobacterium tuberculosis esxH, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~26.25kD

Amino Acid Sequence:
SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.