Fibroblast Growth Factor 21, Recombinant, Mouse, aa29-210, His-Tag (FGF-21, FGF21)

Blue Ice

23, 9

Supplied as a liquid in Tris, 50% glycerol.

Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.

Source:
Recombinant protein corresponding to aa29-210 from mouse Fibroblast Growth Factor 21, fused to 6xHis-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~23.9kD

Amino Acid Sequence:
AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.