Cytochrome P450 3A7 (CYP3A7) Recombinant, Human

Blue Ice

21

Supplied as lyophilized powder from 20mM Tris, 150Mm sodium chloride, pH 8.0, 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose, Proclin-300. Reconstitute with 20mM Tris, 150Mm sodium chloride, pH 8.0 to a concentration of 0.1-1mg/ml. Do not vortex.

Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human CYP3A7expressed in E. coli (P24462).

Amino Acid Sequence:
PPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRD

Predicted Molecular Mass:
19.1kD

Predicted Isoelectric Point:
9.3

Accurate Molecular Mass:
21kD as determined by SDS-PAGE reducing conditions

Subcellular Location:
Endoplasmic reticulum membrane. Peripheral membrane protein

Tissue Specificity:
Liver

Applications:
Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Included Protein Molecular Weight Marker:
168631: Unstained Protein Molecular Weight Marker, 10-70kD
Suppled as a liquid in 62.5mM Tris-H3PO4, pH 7.5, 1mM EDTA, 2% SDS, 100mM DTT, 1mM sodium azide, 0.01% bromo-phenol blue, 33% glycerol. Ready to use; no need to heat, dilute or add reducing agents before use.

Protein Bands: 10kD, 14kD, 18kD, 22kD, 26kD, 33kD, 44kD and 70kD.
Double Intesity Bands: The 26kD, 18kD and 10kD bands are at double intensity to make location and size approximation of proteins easier.

Usage: Allow the marker to reach room temperature and mix thoroughly before use to ensure that any solids that may have precipitated at -20°C will go back into solution. Do not boil! Load the following volumes on SDS-PAGE gel:
Mini gels: 3-5ul/well
Large gel: 7ul/well
The loading volumes listed above are recommended for gels with thickness of 0.75-1mm. The loading volume should be doubled for 1.5mm thick gels.
Store at -20°C Stable for 6 months after receipt.

Storage and Stability:
Lyophilized powder may be stored at -70°C. Stable for 6 months after receipt. Reconstitute with sterile 20mM Tris, 150Mm sodium chloride, pH 8.0. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Note:
Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.