« Back
Home /
ACTH (7-38), human

ACTH (7-38), human

Item no.	AS-20618
Manufacturer	AnaSpec
CASRN	68563-24-6
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
Citations	Ref: Malendowicz, L. et al. J. Steroid Biochem. Mol. Biol. 67, 149 (1998); Li, CH. et al. Proc. Natl. Acad. Sci. USA 75, 4306 (1978)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Adrenocorticotropic Hormone (ACTH)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3659.4
Manufacturer - Research Area	Hormones; Cell Signaling / Hypothalamo-Pituitary (HPA) Axis; GPCR
Description	Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.
Sequence One-Letter Code	FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535054298

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-20618-safety-datasheet.pdf