« Back
Home /
Calcitonin, human

Calcitonin, human

Item no.	AS-20673
Manufacturer	AnaSpec
CASRN	21215-62-3
Amount	1 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: 1-7)
Citations	Ref: Raddino, R. et al. J. Cardiovas. Pharmacol. 29, 463 (1997); Rotella, C. et al. Eur. J. Pharmacol. 107, 347 (1985); Moriarty, et al. Biochem Biophys Res. Commun. 245, 344 (1998); Chen, W. et al. Mol. Pharmacol. 52, 1164 (1997).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Calcitonin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3418.1
Manufacturer - Research Area	Hormones; Cell Signaling / Other Hormones; Calcium Metabolism; GPCR
Description	Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.
Sequence One-Letter Code	CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535054106

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-20673-safety-datasheet.pdf