« Back
Home /
Parathyroid Hormone (1-34), human - 1 mg

Parathyroid Hormone (1-34), human - 1 mg

Item no.	AS-20708
Manufacturer	AnaSpec
Amount	1 mg
Category	Oncology Peptides & Proteins Peptides By Organ Thyroid Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Citations	Ref: Shao, J. et al. J. Biol. Chem. 278, 50195 (2003); Shew, RL. and PKT. Pang Peptides 5, 485 (1984).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4118
Description	Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1-34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Product Group	LB1A1Z
Research Area	Cell Signaling; Hormones / Lyophilized
Sequence One-Letter Code	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
GTIN	5400535053987
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-20708-safety-datasheet.pdf