« Back
Home /
TIP 39, Tuberoinfundibular Neuropeptide, Parathyroid Hormone 2 Receptor Agonist

TIP 39, Tuberoinfundibular Neuropeptide, Parathyroid Hormone 2 Receptor Agonist

Item no.	AS-21687
Manufacturer	AnaSpec
CASRN	277302-47-3
Amount	1 mg
Category	Oncology Peptides & Proteins Peptides By Organ Thyroid Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH
Citations	Ref: Usdin, TB. et al. Nat. Am. 2, 941 (1999); Piserchio, A. et al. J. Biol. Chem. 275, 27284 (2000).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Parathyroid Hormone (PTH)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4504.5
Manufacturer - Research Area	Cell Signaling; Hormones / Calcium Metabolism; Other Hormones
Description	This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.
Sequence One-Letter Code	SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535049621

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-21687-safety-datasheet.pdf