Comparison

Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human, mouse, rat, bovine, guinea pig

Item no. AS-22463
Manufacturer AnaSpec
CASRN 107444-51-9
Amount 1 mg
Category
Type Peptides
Format Lyophilized
Specific against other
Conjugate/Tag Unconjugated
Purity Peak Area by HPLC ≥95%
Sequence H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Citations Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999)Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Shipping Condition Room temperature
Available
Manufacturer - Category
Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets
Glucagon-Like Peptide 1 (GLP-1)
Shipping Temperature
RT
Storage Conditions
- 20 °C
Molecular Weight
3297.9
Manufacturer - Research Area
Diabetes/Metabolism; Hormones; Cell Signaling / Incretins & related Hormones; Gastrointestinal Tract; GPCR
Description
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37) also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence One-Letter Code
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Post Synthesis Coupling
No
Usage
Research use
UNSPSC
12352202
GTIN
5400535046767

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close