« Back
Home /
B-type Natriuretic Peptide, BNP-32, human

B-type Natriuretic Peptide, BNP-32, human

Item no.	AS-24015
Manufacturer	AnaSpec
CASRN	114471-18-0
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bridge: 10-26)
Citations	Ref: Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Sudoh, T. et al. Nature 332, 78 (1988); Cheung, B. et al. JAMA 280, 1983 (1998); Struthers, A. BMJ 308, 1615 (1994); De Lemos, JA. et al. Lancet 362, 316 (2005); Kambayashi, Y. et al. Biochem. Biophys. Res. Commun. 159, 1427 (1989).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Natriuretic Peptide
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3464.2
Manufacturer - Research Area	Cardiovascular Research / Vasoconstriction/Vasodilation
Description	B-type (Brain) natriuretic peptide (BNP) is a 32 amino acid hormone initially isolated from the porcine brain, but mainly produced by the heart ventricles. It is released from a prepro-hormone after cleavage of a signal peptide and further processing by a protease with a conserved recognition sequence (RXXR-S). This cleavage generated NT-proBNP (76aa) and the biologically active 32aa BNP-32, which are secreted in blood in equimolar concentrations. BNP-32 is secreted by cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is known to oppose the renin-angiotensin-aldosterone system and exert vasodilatory effects. This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides.
Sequence One-Letter Code	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535041038

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-24015-safety-datasheet.pdf