« Back
Home /
B-type Natriuretic Peptide, BNP-32, human - 0.5 mg

B-type Natriuretic Peptide, BNP-32, human - 0.5 mg

Item no.	AS-24015
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bridge: 10-26)
Citations	Ref: Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Sudoh, T. et al. Nature 332, 78 (1988); Cheung, B. et al. JAMA 280, 1983 (1998); Struthers, A. BMJ 308, 1615 (1994); De Lemos, JA. et al. Lancet 362, 316 (2005); Kambayashi, Y. et al. Biochem. Biophys. Res. Commun. 159, 1427 (1989).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Natriuretic Peptide
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3464.2
Description	This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Product Group	LB1A3Z
Research Area	Cardiovascular Research / Lyophilized
Sequence One-Letter Code	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
GTIN	5400535041038
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-24015-safety-datasheet.pdf