Beta-Amyloid (1-38) Peptide

Item no.	AS-24233
Manufacturer	AnaSpec
CASRN	131438-74-9
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, Beta-Amyloid fragment
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4131.9
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofA?1-40, while a minor product is A? 1-42. Additional minor A? peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535040482

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-24233-safety-datasheet.pdf