« Back
Home /
Beta-Amyloid (1-38), mouse, rat

Beta-Amyloid (1-38), mouse, rat

Item no.	AS-62476
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, Beta-Amyloid fragment
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4035.8
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence One-Letter Code	DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535148959

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-62476-safety-datasheet.pdf