« Back
Home /
[Lys22]-beta-Amyloid (1-40), Italian Mutation

[Lys22]-beta-Amyloid (1-40), Italian Mutation

Item no.	AS-62147
Manufacturer	AnaSpec
CASRN	302905-01-7
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Citations	Masuda, Y. et al. Bioorg. Med. Chem. 13, 6803 (2005).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, beta-amyloid (1-40)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4329.2
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the Italian mutation (E22K) leads to beta-amyloid peptides which aggregate more rapidly and exhibit potent neurotoxicity compared to wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might explain why E22K-beta-amyloid 1-40 is more pathogenic than its wild-type conterpart.
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535149741

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-62147-safety-datasheet.pdf