« Back
Home /
LC-LL-37, with Cys in Nterm

LC-LL-37, with Cys in Nterm

Item no.	AS-63692
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Cys-LC-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	LL-37
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4709.9
Manufacturer - Research Area	Immunology and Infectious disease; Cell Signaling / Microbiology/Bacteriology; GPCR
Description	Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds. This peptide contains a Cys in Nterm.
Sequence One-Letter Code	C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535147273

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-63692-safety-datasheet.pdf