« Back
Home /
Exendin (5-39)

Exendin (5-39)

Item no.	AS-63898
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Citations	Montrose-Rafizadeh, C. et al. J Biol Chem 272, 21201 (1997)Eng, J. et al. J Biol Chem 267, 7402 (1992)Greig, NH. et al. Diabetolog 42, 45 (1999)Göke R. et al. J Biol Chem 268, 19650 (1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Exendin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3806.5
Manufacturer - Research Area	Diabetes/Metabolism / Incretins & related Hormones
Description	This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (5-39) antagonizes GLP-1–stimulated insulin release after food intake.
Sequence One-Letter Code	TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535146375

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-63898-safety-datasheet.pdf