Comparison

Glucagon-Like Peptide 1, GLP-1 (9-36), amide, human, mouse, rat, bovine, guinea pig

Item no. AS-65070
Manufacturer AnaSpec
CASRN 161748-29-4
Amount 1 mg
Category
Type Peptides
Format Lyophilized
Specific against other
Conjugate/Tag Unconjugated
Purity Peak Area by HPLC ≥95%
Sequence H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Citations John, H. et al. Eur J Med Res 13, 73 (2008)Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Shipping Condition Room temperature
Available
Manufacturer - Category
Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets
Glucagon-Like Peptide 1 (GLP-1)
Shipping Temperature
RT
Storage Conditions
- 20 °C
Molecular Weight
3089.6
Manufacturer - Research Area
Diabetes/Metabolism; Hormones; Cell Signaling / Incretins & related Hormones; Gastrointestinal Tract; GPCR
Description
GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36) amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36) amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36) amide however was shown to exert cardioprotective actions in rodent hearts. - Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic ?-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.
Sequence One-Letter Code
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Post Synthesis Coupling
No
Usage
Research use
UNSPSC
12352202
GTIN
5400535141141

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close