Comparison

Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant

Manufacturer Angio-Proteomie
Category
Type Proteins Recombinant
Specific against other
Amount 1000ug
Item no. ANG-rAP-2265-1000ug
Targets GHR, GH1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Description
Product Name: Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant
Synonyms: GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Description: Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton. The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.
Uniprot Accesion Number: P09538
Amino Acid Sequence:AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL.
Source: Escherichia Coli.
Physical Appearance and Stability: Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18° C. Upon reconstitution and filter sterilization GH can be stored at 4° C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Formulation and Purity: The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8. Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
Application:
Solubility: It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100µ g/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
Biological Activity: Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
Shipping Format and Condition: Lyophilized powder at room temperature.
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close