Comparison

Pro-Nerve Growth Factor Human Recombinant

Item no. ANG-rAP-2656-100ug
Manufacturer Angio-Proteomie
Amount 100 ug
Quantity options 100 ug 10 ug 1 ea 2 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Human Pro-NGF, ProNGF, NGFB.
Shipping Condition Room temperature
Available
Shipping Temperature
Lyophilized powder at room temperature.
Usage statement
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
Amino Acid Sequence:MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Physical Appearance and Stability: Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution ProNGF should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.
Formulation and Purity: ProNGF was lyophilized from a 0.2 uM filtered solution of 20mM PB and 250mM NaCl pH 7.2. Greater than 95.0% as determined by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close