« Back
Home /
Human Papillomavirus 11 Recombinant

Human Papillomavirus 11 Recombinant

Item no.	ANG-rAP-5452-1000ug
Manufacturer	Angio-Proteomie
Amount	1000 ug
Quantity options	1000 ug 100 ug 1 ea 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
Sequence	VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQM
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Papillomavirus, HPV, Papilloma Virus.
Available
Manufacturer - Applications	Each laboratory should determine an optimum working titer for use in its particular application.
Shipping Temperature	Lyophilized powder at room temperature
Usage statement	Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description	Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.
Physical Appearance and Stability	Recombinant HPV-11 although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
Formulation and Purity	Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine. Protein is > 90% pure as determined by 10% PAGE (coomassie staining).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ANG-rAP-5452-1000ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 ug

available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question