Comparison

West Nile Virus Pre-M Recombinant

Item no. ANG-rAP-5505-500ug
Manufacturer Angio-Proteomie
Amount 500 ug
Quantity options 1000 ug 100 ug 1 ea 500 ug
Category
Type Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Description
Description: The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.
Amino Acid Sequence:MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Physical Appearance and Stability: WNV Pre-M although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
Formulation and Purity: 20mM phosphate buffer pH 7.5. Protein is > 95% pure as determined by SDS-PAGE.
Application: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Biological Activity:
Shipping Format and Condition: Lyophilized powder at room temperature.
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close